SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004703 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004703
Domain Number 1 Region: 21-136
Classification Level Classification E-value
Superfamily Immunoglobulin 5.05e-18
Family V set domains (antibody variable domain-like) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004703   Gene: ENSMMUG00000003532   Transcript: ENSMMUT00000004994
Sequence length 245
Comment pep:known_by_projection chromosome:MMUL_1:13:88453356:88473067:-1 gene:ENSMMUG00000003532 transcript:ENSMMUT00000004994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRLWLLLAAQLAVVRGSSVLQQTPAYIQVQTNKMAMLSCEAKISLGNMRIYWLRQRQA
PSSDSHHEFLALWDSTKGTVHGEEVAQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIIG
SPELTFGKGTQLSVVDFLPTTAQPTKKSTPKKRGCRLPRPTQKGPLCSPITLGLLVAGVL
VLLVSLGVAIHLYCRRRRARLRFIKQKFNIVCLKIRGFTTCCCFQVLQMSREYGFGVLLQ
KDIGQ
Download sequence
Identical sequences ENSMMUP00000004703 ENSMMUP00000004703 9544.ENSMMUP00000004703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]