SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004736 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004736
Domain Number 1 Region: 484-716
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.3e-36
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number 2 Region: 97-243,288-366
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-31
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 1241-1400,1437-1514
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-31
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number 4 Region: 1583-1707,1741-1810
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.51e-17
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004736   Gene: ENSMMUG00000003555   Transcript: ENSMMUT00000005027
Sequence length 2099
Comment pep:known_by_projection chromosome:MMUL_1:19:12884939:13188949:-1 gene:ENSMMUG00000003555 transcript:ENSMMUT00000005027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFGDEMPARYGGGGSGAAAGVVVGAGGGRGAGGSRQGGQPGAQRMYKQSMAQRARTMA
LYNPIPVRQNCLTVNRSLFLFSEDNVIRLYFSLIPQYPFEYMILATIIANCIVLALEQHL
PDDDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTGI
LATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAILIFA
IIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGITQF
DNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLSG
EFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDGEQRHPFDALR
RATIKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMRFYIRR
MVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKMYGLG
TRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWASLRN
LVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAIMTVF
QILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQE
LTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAMKEQQKNQKPAKSVWEQRTSEM
RKQNLLASREALYNEMDPDERWKAAYTRHLRPDMKTHLDRPLVVDPQENRNNNTNKSRAA
EPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGRES
DHHAREGSLEQPGFWEGEAERGKAGDPHRRHVHRQGGSRESRSGSPRTGADGEPRRHRGH
RRPGEEGPEDKAERRARHREGSRPARGGEGEGEGPDGGERRRRHRHGAPATYEGDPRRED
KERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESAGP
HDSLGHAGLPQSPAKMGNSTDPGPTPAIPAMATNPQNAASRRMPNNPGNPSNPGPPKTPE
NSLIVTNPSGTQTNSAKTARKPDHTTVDIPPACPPPLNHTVVQVNKNANPDPLPKKEDEK
KEEEEDDRGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMSSIALA
AEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIVVS
GALVAFAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFNILI
VYMLFMFIFAVVAVQLFKGKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWKKYEFH
YDNVLWALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFFF
VNIFVALIIITFQEQGDKMMEEYSLEKNEEDCLSPGVQEQPEQHRRERRIRLQFDLAHLV
AVSPQASGLTSLSLYFCHLQSEFYGASVAYENALRVFNIVFTSLFSLECVLKVMAFGILN
YFRDAWNIFDFVTVLGSITDILVTEFGNNFINLSFLRLFRAARLIKLLRQGYTIRILLWT
FVQSFKVSPLTSLSNAVRPYLYKKKGMGGQGMAGEGEREREGKENKKAYQFKNVNSLPSA
PSKRRWSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSFLMLNL
FVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAACGRIHYKDMYSLLRVISPPLGL
GKKCPHRVACKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKGGADKQQMDAELRK
EMMAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQDRTP
LMFQRMEPPSPTQEGGPGQNALPSAQLDPGGALMAHESGLKESPSWVTQRAQEMFQKTGT
WSPERGPPTDMPNSQPNSQSVEMREMGRDGYSDSEHYLPMEGQGRAASMPRLPAENQVR
Download sequence
Identical sequences ENSMMUP00000004736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]