SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004776 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004776
Domain Number 1 Region: 7-151
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.48e-21
Family Rhodopsin-like 0.012
Further Details:      
 
Domain Number 2 Region: 173-255
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000944
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004776   Gene: ENSMMUG00000003581   Transcript: ENSMMUT00000005069
Sequence length 347
Comment pep:known chromosome:MMUL_1:1:114483953:114510826:-1 gene:ENSMMUG00000003581 transcript:ENSMMUT00000005069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNNSTAPSLTDVTYITMEIFIGLCAIVGNVLVIWVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAVVVSLGITIHFYSCLFMACLLLIFTHASIMSLLAIAVDRYLRVKLTVRFRI
PGLPGCILSFQLKVCFLPVMWLFILLSLALFSDAMVMDEKVKESFVLDTASAICNYNARY
KDHPKYWCRGYFRDYCNIIAFSPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRD
FARDDMDFTELIVTDNKGTLANDFWSGKDLSGNKTRSCKAPKVVGETDHSRTSILIICIL
ITGLGIISIISHLTKRRRSQRNRRVGNSLKPFSRVLTPKEMAPTEQM
Download sequence
Identical sequences F7ENK5 I7GLL2
9544.ENSMMUP00000004776 ENSMMUP00000004780 NP_001289709.1.72884 XP_005542410.1.63531 ENSMMUP00000004776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]