SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005022 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005022
Domain Number 1 Region: 25-204
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.58e-86
Family MHC antigen-recognition domain 0.0000000441
Further Details:      
 
Domain Number 2 Region: 207-299
Classification Level Classification E-value
Superfamily Immunoglobulin 5.14e-32
Family C1 set domains (antibody constant domain-like) 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005022   Gene: ENSMMUG00000003765   Transcript: ENSMMUT00000005334
Sequence length 361
Comment pep:known scaffold:MMUL_1:1099214731354:21972:24535:1 gene:ENSMMUG00000003765 transcript:ENSMMUT00000005334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVMAPRTLLLLLSGALALTETWAGSHSLRYFHTAVSRPGRWEPRFISVGYVDDTQFVRFD
SDAESPRMEPRAPWMEQEGPEYWEEQTRIAKEAAQTFRGNLRTLRGYYNQSETGSHTLQW
MYGCDLGPDGRLLRGYDQSAYDGRDYIVLNEDLRSWTAADMAAQNTQRKWEAARAAERQR
AYLEGECLEWLRRYLENGKEMLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTW
QRDGEEQTQDTELVETRPGGDGTFQKWAAVVVPSGEEHRYRCHVQHEGLPEPVTLRWEPS
SQSTIPIVGIVVGLAVLAVVVTGAVVAAVMWRRKSSGGQLGSYSQAACSNSAQSSYVSLM
D
Download sequence
Identical sequences ENSMMUP00000005022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]