SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005171 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005171
Domain Number 1 Region: 286-403
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000157
Family C1 set domains (antibody constant domain-like) 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000005171
Domain Number - Region: 251-297
Classification Level Classification E-value
Superfamily Immunoglobulin 0.04
Family I set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005171   Gene: ENSMMUG00000003875   Transcript: ENSMMUT00000005492
Sequence length 448
Comment pep:known chromosome:MMUL_1:4:33015527:33028759:-1 gene:ENSMMUG00000003875 transcript:ENSMMUT00000005492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLSLLLAVALGLATAVSAGPAVIECWFVEDTSGKGLAKRPGALLLRQGQGEPPPRPDL
DPELYLNVHDPAGFLQAAFRRYPRDAPAPHCEMSRFVPLPASANWASGLTPARNCPRALD
GAWLMVSMSSPVLSLSSLLRRQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDL
SFAYMPPTSEAASSLAAGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAA
WDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPAT
LAWAAPGEAPPELLCLVSHFYPPGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSV
SLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSIGLFLSA
FLLLGLFKALGWAAVYLSTCKDSKKKAE
Download sequence
Identical sequences I0FLP9
NP_001248656.1.72884 ENSMMUP00000005171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]