SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005179 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005179
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 9.15e-22
Family Ribosomal L11/L12e N-terminal domain 0.0000333
Further Details:      
 
Domain Number 2 Region: 72-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.000000000196
Family Ribosomal protein L11, C-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005179   Gene: ENSMMUG00000003881   Transcript: ENSMMUT00000005501
Sequence length 158
Comment pep:novel chromosome:MMUL_1:12:71953408:71953897:-1 gene:ENSMMUG00000003881 transcript:ENSMMUT00000005501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKFSPNKIKVMYLRCIGDEVGAMSALAPKIGPLGLSPKRLVMTLPSMGDWKGLRITVKLT
IQNRQAQIEVVPSASALIIKALKETPRDRKKQKNIKHSGNITCDEIVNVQHPSLARELSG
TIKEIRETALSMGHNVDGHQPHDIIDGINSVVVECLAS
Download sequence
Identical sequences ENSMMUP00000005179 ENSMMUP00000005179 9544.ENSMMUP00000005179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]