SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005183 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005183
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 8.64e-36
Family MHC antigen-recognition domain 0.00000636
Further Details:      
 
Domain Number 2 Region: 94-186
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-31
Family C1 set domains (antibody constant domain-like) 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005183   Gene: ENSMMUG00000003886   Transcript: ENSMMUT00000005506
Sequence length 251
Comment pep:novel scaffold:MMUL_1:1099214727737:15:2980:1 gene:ENSMMUG00000003886 transcript:ENSMMUT00000005506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSHTIQRVFGCDLGPDWRLLRGYNPHAYDGKDYIALNEDLRSWTAADTAAQNTQRKWEAC
GEAEEWSVYLEGECLEWLRRHLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYP
AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVSPGEEQRYTCHVQHKGLLEPL
TLRWEPSSQSAIPILGFVAGLAVLAFLVTGAVVTAVLWRRKSSGGKGGSYSQAVSSDSAQ
GSDVSLRDCKG
Download sequence
Identical sequences ENSMMUP00000005183 ENSMMUP00000005183 9544.ENSMMUP00000005183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]