SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005199 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005199
Domain Number 1 Region: 818-1120
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.85e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000297
Further Details:      
 
Domain Number 2 Region: 19-282
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.54e-76
Family Carbonic anhydrase 0.00000762
Further Details:      
 
Domain Number 3 Region: 1133-1407
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.01e-72
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000143
Further Details:      
 
Domain Number 4 Region: 291-391
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000476
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005199   Gene: ENSMMUG00000012418   Transcript: ENSMMUT00000005523
Sequence length 1437
Comment pep:known_by_projection chromosome:MMUL_1:3:159454537:159588492:1 gene:ENSMMUG00000012418 transcript:ENSMMUT00000005523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDWANGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLK
KLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSD
GSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIID
GVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISEN
QLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSYTGKEEIHEAVCSSEPENV
QADPENYTSLLVTWERPRVVYDTMIEKFAVLYQQLDGEDQTKHEFLTDGYQDLGAILNNL
LPNMSYVLQIVAICTNGLYGKYSDQLIVDMPTDNPELDLFPELIGTEEIIKEEEKGKDVE
EDAVVNPGRDSATNQIRKKEPRISTTTHYNRIRTKYNEAKTNRSPTRGSEFSGKGDVPNT
SLNSTSQPITKLATEKDISLTSQTVTELPPHTVEGTSASLNDGSKTVLRSPHMNLSGTAE
SLNTVSITEYEEESLLTSFKLDTGADDSSGSSPATSAIPFISENISQGYIFSSENPETIT
YDVLIPESARNASEDSTSSGSEESLKDPSVEGNVWFPSFTDVTAQPDIGSGRESFLQTNY
TEIHVDESEKTTKSFSAGPVMSQGPSVTDLEMPHYSTFAYFPTEVTPHAFTPSSRQQDLV
STVNVVRSQTTQPVYNEASNSSHESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGI
LIYWRKCFQTAHFYLEDSTSPRVISTPPTPIFPISDDVGAIPIKHFPKHVADLHASSGFT
EEFETLKEFYQEVQSCTVDLGITADSSNHPDNKHKNRYINIVAYDHSRVKLAQLAEKDGK
LTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCD
QYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFSLRNTKIKKGSQKGRPSGRVVTQYHYTQ
WPDMGVPEYSLPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGT
VNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPT
GKTKLEKQFQLLSQSNIQQSDYSTALKQCNREKNRTSSIIPVERSRVGISSLSGEGTDYI
NASYIMGYYQSNEFIITQHPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNK
DEPINCESFKVTLMAEEHKCLTNEEKLIIQDFILEATQDDYVLEVRHFQCPKWPNPDSPI
SKTFELISVIKEEAANRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKENSVDVYQVAKMI
NLMRPGVFADIEQYQFLYKVILSLVSTRQEENPSTSLDSNGAALPDGNLAESLESLV
Download sequence
Identical sequences ENSMMUP00000005199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]