SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005253 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005253
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily Immunoglobulin 5.29e-35
Family V set domains (antibody variable domain-like) 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005253   Gene: ENSMMUG00000032413   Transcript: ENSMMUT00000005579
Sequence length 93
Comment pep:novel scaffold:MMUL_1:1099214725231:8640:8918:1 gene:ENSMMUG00000032413 transcript:ENSMMUT00000005579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSALTQPPSVSKSLGQSVTISCTGTSSDIGGYNDVSWYQQHPGTAPRLLIYEVSKRPSGV
SDRFSGSKSGNTASLTISGLQAEDEADYYCCSY
Download sequence
Identical sequences ENSMMUP00000005253 ENSMMUP00000005253 9544.ENSMMUP00000005253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]