SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005291 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005291
Domain Number 1 Region: 215-642,675-751
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.71e-196
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000153
Further Details:      
 
Domain Number 2 Region: 6-214
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.31e-70
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005291   Gene: ENSMMUG00000003962   Transcript: ENSMMUT00000005619
Sequence length 792
Comment pep:known chromosome:MMUL_1:14:69423324:69468982:-1 gene:ENSMMUG00000003962 transcript:ENSMMUT00000005619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA
AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKST
LDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHK
EDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIY
LEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLD
EVWGEEFEKLYESYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL
GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKI
IDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGAL
EASCDLAKEQGPYETYEGSPVSKGILQYDMWNVTPTDLWDWNLLKENIAKYGIRNSLLIA
PMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQII
ACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKISKEEEEKERNTAAMVCS
LENRDECLMCGS
Download sequence
Identical sequences A0A2K6CGH0 G7PQZ6 H9FY72
ENSMMUP00000005291 ENSMMUP00000005291 NP_001252816.1.72884 XP_005578999.1.63531 XP_011717168.1.29376 9544.ENSMMUP00000005291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]