SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005613 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005613
Domain Number 1 Region: 85-651
Classification Level Classification E-value
Superfamily Urocanase 1.7e-221
Family Urocanase 0.0000000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005613   Gene: ENSMMUG00000004197   Transcript: ENSMMUT00000005961
Sequence length 676
Comment pep:known_by_projection chromosome:MMUL_1:2:46257128:46293380:-1 gene:ENSMMUG00000004197 transcript:ENSMMUT00000005961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLQALCSGLPLRPLPENRGRQAGVPHAPVRTPGLSLAEKQLALRNALRYFPADVQELL
APEFAQELQLYGHIYMYRFCPDIEMRAYPVEQYPCQTKAAAAIMHMIMNNLDPAVAQFPQ
ELVTYGGNGQVFSNWAQFWLTMFYLSKMTEEQTLVMYSGHPLGLFPSSCSAPRLVITNGM
VIPNYSSRMEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAARRYLGIEDLA
GKVFVTSGLGGMSGAQAKAAVIVGCIGVIAEVDKAALEKRHKQGWLMEVTDSLDRCIQRL
REARKRKEVLSLGYHGNVVALWERLVHELDTTGECLVDLGSDQTSCHNPFNGGYYPVQLS
FTEAQSLMASNPAVFKDLVQESLRRQVSAINRLAKEKFFFWDYGNAFLLEAQRAGADVEK
KGAGRTEFRYPSYVQHIMGDIFSQGFGPFRWVCTSGDPQDLAVTDELATSVLEEAIANGV
KASVKLQYMDNIRWIREAARHQLVVGSQARILYSDQKGRVAIAVAINQAIACRRIKAPVV
LSRDHHDVSGTDSPFRETSNIYDGSAFCADMAVQNFVGDACRGATWVALHNGGGVGWGEV
INGGFGLVLDGTPEAEQRARLMLSWDVSNGVARRCWSGNQKAYEIICQTMQENSSLVVTL
PHEVEDERVLQQALQL
Download sequence
Identical sequences F6Z471
XP_001114316.1.72884 ENSMMUP00000005613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]