SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005615 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005615
Domain Number 1 Region: 374-724
Classification Level Classification E-value
Superfamily Urocanase 1.7e-125
Family Urocanase 0.0000022
Further Details:      
 
Domain Number 2 Region: 96-312
Classification Level Classification E-value
Superfamily Urocanase 9.68e-89
Family Urocanase 0.00000896
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005615   Gene: ENSMMUG00000004197   Transcript: ENSMMUT00000005963
Sequence length 749
Comment pep:known_by_projection chromosome:MMUL_1:2:46257691:46293382:-1 gene:ENSMMUG00000004197 transcript:ENSMMUT00000005963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCWPLPPSQLHMSSLQALCSGLPLRPLPENRGRQAGVPHAPVRTPGLSLAEKQLALRNAL
RYFPADVQELLAPEFAQELQLYGHIYMYRFCPDIEMRAYPVEQYPCQTKAAAAIMHMIMN
NLDPAVAQFPQELVTYGGNGQVFSNWAQFWLTMFYLSKMTEEQTLVMYSGHPLGLFPSSC
SAPRLVITNGMVIPNYSSRMEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNA
ARRYLGIEDLAGKVFVTSGLGGMSGAQAKAAVIVGCIGVIAEVDKAALEKRHKQGWLMEV
TDSLDRCIQRLRVLQLGLQQAPGWAGLPAALGLCVLSYLVDLAPLGEGRCPAPSGFSRPL
PVRGAPVLLLCPSREARKRKEVLSLGYHGNVVALWERLVHELDTTGECLVDLGSDQTSCH
NPFNGGYYPVQLSFTEAQSLMASNPAVFKDLVQESLRRQVSAINRLAKEKFFFWDYGNAF
LLEAQRAGADVEKKGAGRTEFRYPSYVQHIMGDIFSQGFGPFRWVCTSGDPQDLAVTDEL
ATSVLEEAIANGVKASVKLQYMDNIRWIREAARHQLVVGSQARILYSDQKGRVAIAVAIN
QAIACRRIKAPVVLSRDHHDVSGTDSPFRETSNIYDGSAFCADMAVQNFVGDACRGATWV
ALHNGGGVGWGEVINGGFGLVLDGTPEAEQRARLMLSWDVSNGVARRCWSGNQKAYEIIC
QTMQENSSLVVTLPHEVEDERVLQQALQL
Download sequence
Identical sequences ENSMMUP00000005615 9544.ENSMMUP00000005615 ENSMMUP00000005615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]