SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005632 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005632
Domain Number 1 Region: 17-131
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-28
Family Kringle modules 0.00091
Further Details:      
 
Domain Number 2 Region: 161-229
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000963
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005632   Gene: ENSMMUG00000004212   Transcript: ENSMMUT00000005981
Sequence length 325
Comment pep:known_by_projection chromosome:MMUL_1:20:3105712:3108943:1 gene:ENSMMUG00000004212 transcript:ENSMMUT00000005981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQDLQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPC
LFWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCH
MPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLTFRLFELADPRDRLELR
DAASGSLLRAFDGARPPPPGPLRLGTAALLLTFRSDARGHAQGFALTYRGLQDAAEDPAA
PEGSAQTPAAPLDGANVSCSPRPGAPQAAMGGAVCWLREKGPRRWGLPGAPGEAGLCGTD
SPEGCPCPAPLGTPRLRVLLRATGL
Download sequence
Identical sequences ENSMMUP00000005632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]