SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005740 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005740
Domain Number 1 Region: 100-144
Classification Level Classification E-value
Superfamily LysM domain 0.000000144
Family LysM domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005740   Gene: ENSMMUG00000004290   Transcript: ENSMMUT00000006097
Sequence length 928
Comment pep:known_by_projection chromosome:MMUL_1:4:138011137:138089678:-1 gene:ENSMMUG00000004290 transcript:ENSMMUT00000006097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLRLKKKKQAKQNAETASAMATRTHTGKEDANTVVLEPDKCNIAVEEEYMTDEKKKRKSN
QLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPHGTMEYTAGNQDTLNSIALKFNIT
PNKLVELNKLFTHTIVPGQVIILVYNSRSSAFTFYCHFQCLTIVLLLFDFEIFCFHKDAD
LARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVMIVTPNNIMFDPHKS
DPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQDLCPLYRPGEWEDLA
SEKDINPFSKFKSINKEKRQQNGEKIMTSDSRPTVPLEKSTEHTPTKPSGSSVSEKLKKL
ESSRETSHGSPTVTKLSKEPSNTSAAFESTAKENFLGEDDDFVDLEELSSQTDGGMDKKD
TSKECLSLDPEERKKVESQINNSAVEMQVQSALAFLGTENDVELKGALDLETCEKQDIMP
EVDKQSGSPESRVENTLNIHEDLDKVKLIEYYLNKNKEGSQVSENLQKTELSDGKSIEPG
GIDITLSSSLSQSGNPLTEGNKEPDKTCVKEREPLPVKLNSSTEENVIKEALDSSLESTL
DNSCQGAQMDNKSEVQLWLLKRIQVPIEDILPSKAEKSKTPPMFLCIKVGKPMRKSFATH
TAAMVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAKEQGFVVVEKEELNM
IDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEDEDEEVLPVLRPHSALLENMHIEQLARR
LPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMDNQIFGAYATHPFKFS
DHYYGTGETFLYTFSPHFKVFKWSGENSYFINGDISSLELGGGGGRFGLWLDADLYHGRS
NSCSTFNNDILSKKEDFIVQDLEVWAFE
Download sequence
Identical sequences ENSMMUP00000005740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]