SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005786 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005786
Domain Number 1 Region: 21-167
Classification Level Classification E-value
Superfamily C-type lectin-like 1.01e-51
Family Link domain 0.000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005786   Gene: ENSMMUG00000004327   Transcript: ENSMMUT00000006145
Sequence length 361
Comment pep:known chromosome:MMUL_1:14:36608789:36697777:-1 gene:ENSMMUG00000004327 transcript:ENSMMUT00000006145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKFRWHAAWGLCLLQLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSVGFETCRYGFIEGHVVIPRIQPNSICAANHTGVYILTSNTSQYDTYCFN
ASAPPKEDCTSVTDLPNAFDGPITITIVNPDGTRYIKKGEYRTNPEDIYPSNPTDDDVSS
GSSSERSSTSGGYIFHTFSTAHPIPDEDGPWITDSTDRIPATRDQDAFYPSGGSHTTHGS
ESAGHSHGSQEGGANTTSGPVRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKK
LVINSGNGAVDDRKPSGLNGEASKSQEMVHLVNKEPSETPDQFMTADETRNLQNVDMKIG
V
Download sequence
Identical sequences A0A2K5VJ78 H9Z063
XP_005578263.1.63531 XP_014970024.1.72884 ENSMMUP00000005786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]