SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005787 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005787
Domain Number 1 Region: 21-79
Classification Level Classification E-value
Superfamily C-type lectin-like 2.05e-18
Family Link domain 0.0000901
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005787   Gene: ENSMMUG00000004327   Transcript: ENSMMUT00000006146
Sequence length 104
Comment pep:known chromosome:MMUL_1:14:36609483:36697611:-1 gene:ENSMMUG00000004327 transcript:ENSMMUT00000006146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKFRWHAAWGLCLLQLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSVGFETCSLHCSQQSKKVWAEEKASDQQWQWSCG
Download sequence
Identical sequences ENSMMUP00000005787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]