SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005792 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005792
Domain Number 1 Region: 431-737
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.68e-54
Family Eukaryotic proteases 0.00055
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-32
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 3 Region: 297-367
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000945
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 234-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000431
Family EGF-type module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005792   Gene: ENSMMUG00000004330   Transcript: ENSMMUT00000006151
Sequence length 737
Comment pep:known chromosome:MMUL_1:14:36301847:36401906:1 gene:ENSMMUG00000004330 transcript:ENSMMUT00000006151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGCWTQLGLTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECVCPGKKE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWGGTLDDFYVKGFYCAECRAGW
YGGDCMRCGQVLRAPKGQILLESYPLNAHCEWTIHTKPGFIIQLRFVMLSLEFDYMCQYD
YVEVRDGDNRDGQIIKRVCGNERPAPIQSTGSSLHVLFHSDGSKNFDGFHAIFEEITACS
SSPCFHDGTCVLDKAGSYKCACLAGYTGQRCENLLEAGKSKIKASEDSLSVLEERNCSDP
GGPVNGYKKITGGPGLINGHHAKIGTVVSFFCNNSYVLSGNEKRTCQQNGEWSGKQPICI
KACREPKISDLVRRRVLPMQVQSRETPLHQLYSAAFSKQKLQSAPTKKPALPFGDLPTGY
QHLHTQLQYECISPFYRRLGSSRRTCLRTGKWSGRAPSCIPICGKIENVTAPKTQGLRWP
WQAAIYRRTSGVHDGSLHKGAWFLVCSGALVNERTVVVAAHCVTDLGKVTMIKTADLKVV
LGKFYRDDDRDEKTIQSLRISAIILHPNYDPILLDADIAILKLLDKARISTRVQPICLAA
SRDLSTSFQESHITVAGWNVLADVRSPGFKNDTLRSGVVSVVDSLLCEEQHEDHGIPVSV
TDNMFCASQDPTAPSDICTAETGGIAAVSFPGRASPEPRWHLMGLVSWSYDKTCSHRLST
AFTKVLPFKDWIERNMK
Download sequence
Identical sequences F6ZDE4
XP_001114978.1.72884 ENSMMUP00000005792 ENSMMUP00000005792 9544.ENSMMUP00000005792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]