SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005927 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005927
Domain Number 1 Region: 66-103
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0000000000000641
Family Ribosomal protein L36 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005927   Gene: ENSMMUG00000004451   Transcript: ENSMMUT00000006303
Sequence length 103
Comment pep:known scaffold:MMUL_1:1099548049351:39381:40854:-1 gene:ENSMMUG00000004451 transcript:ENSMMUT00000006303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANLFIRKMVNPLLYLSRHTVKPRVLSTFLMGSLRGAAPVAVKAGAEVRSLLSPGLLPRL
LPALSFKTKVVLKKRCRDCYLVKRRGRWYVCCKTNPRHKQRQM
Download sequence
Identical sequences G8F2L2 H9H300
9544.ENSMMUP00000005927 NP_001245026.1.72884 XP_005595538.1.63531 XP_005595539.1.63531 XP_011708580.1.29376 XP_011708581.1.29376 XP_014995193.1.72884 ENSMMUP00000005927 ENSMMUP00000005927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]