SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005966 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005966
Domain Number 1 Region: 462-660
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.28e-68
Family Hemopexin-like domain 0.00000000185
Further Details:      
 
Domain Number 2 Region: 89-218,391-446
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.31e-38
Family Matrix metalloproteases, catalytic domain 0.000000522
Further Details:      
 
Domain Number 3 Region: 337-393
Classification Level Classification E-value
Superfamily Kringle-like 2.06e-21
Family Fibronectin type II module 0.0000635
Further Details:      
 
Domain Number 4 Region: 277-334
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-21
Family Fibronectin type II module 0.0000526
Further Details:      
 
Domain Number 5 Region: 221-276
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-20
Family Fibronectin type II module 0.0000528
Further Details:      
 
Domain Number 6 Region: 42-107
Classification Level Classification E-value
Superfamily PGBD-like 3.45e-19
Family MMP N-terminal domain 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005966   Gene: ENSMMUG00000004475   Transcript: ENSMMUT00000006343
Sequence length 660
Comment pep:known chromosome:MMUL_1:20:53723674:53750868:1 gene:ENSMMUG00000004475 transcript:ENSMMUT00000006343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYSKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGSGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Download sequence
Identical sequences A0A1D5QTJ7
ENSMMUP00000005966 9544.ENSMMUP00000005966 ENSMMUP00000005966 XP_001087939.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]