SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006059 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006059
Domain Number 1 Region: 182-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-58
Family Voltage-gated potassium channels 0.00077
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.66e-32
Family Tetramerization domain of potassium channels 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006059   Gene: ENSMMUG00000004559   Transcript: ENSMMUT00000006445
Sequence length 647
Comment pep:known chromosome:MMUL_1:X:46818828:46830528:-1 gene:ENSMMUG00000004559 transcript:ENSMMUT00000006445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGLATWLPFARAAAVGWLPLAQQPLPPAPGVKTSRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGDGPALPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGAARRSSREQPCGERFPQAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLLVPKNDDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTNKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPMGHGSLLSSCCPRRAKRR
AIRLANSTASVSRGSMQELDMLAGLRRSPAPQSRSSLNAKPHDSLDLNCDSRDFVAAIIS
IPTPPANTPDESQPSSPGGGSRAGSTLRNSSLGTPCLFPETVKISSL
Download sequence
Identical sequences A0A096NPF3 A0A2K5JCK4 A0A2K5KQ91 A0A2K6AIJ7 A0A2K6E6Q8 F6S4U3 G7Q2P3
9544.ENSMMUP00000006059 XP_001104621.1.72884 XP_011760211.1.29376 XP_011802076.1.43180 XP_011846776.1.47321 XP_011887608.1.92194 XP_015298925.1.63531 XP_015298926.1.63531 ENSMMUP00000006059 ENSMMUP00000006059 ENSPANP00000014883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]