SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006135 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006135
Domain Number 1 Region: 219-472
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-56
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 36-148
Classification Level Classification E-value
Superfamily POZ domain 9.94e-30
Family Tetramerization domain of potassium channels 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006135   Gene: ENSMMUG00000004614   Transcript: ENSMMUT00000006523
Sequence length 578
Comment pep:known_by_projection chromosome:MMUL_1:1:113277934:113296426:1 gene:ENSMMUG00000004614 transcript:ENSMMUT00000006523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGT
RLAWLADPDGGGRPETDGGGAGGSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCG
PLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGSGPGPSDEAGDDERE
LALQRLGPHEGGAGHGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVSITTF
CLETHEAFNIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRIVCC
PDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRH
FVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNI
PIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAM
AKQKLPKKRKKHVPRPAQLESPMYCKSEETSPRDSTYSDTSPPAREEGMIERKRAGEIRG
WEGKSLFPQWPREFPNEPRPLGFMCFVWGFRKHKSVPI
Download sequence
Identical sequences ENSMMUP00000006135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]