SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006201 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006201
Domain Number 1 Region: 579-715
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-42
Family C-type lectin domain 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006201
Domain Number - Region: 201-407
Classification Level Classification E-value
Superfamily Tropomyosin 0.00209
Family Tropomyosin 0.013
Further Details:      
 
Domain Number - Region: 82-226
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0366
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006201   Gene: ENSMMUG00000004663   Transcript: ENSMMUT00000006592
Sequence length 723
Comment pep:known chromosome:MMUL_1:18:13741699:13779634:1 gene:ENSMMUG00000004663 transcript:ENSMMUT00000006592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYKVVEKMDNVTGGMETSRQTY
DDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKL
QASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQSQMYSH
NVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKNDFQNLQQVFLQAKKDTDWLK
EKVQSLQTLAANNSALAKANNDTLEDMNSQLNSFTGQMENITTISQANEQNLKDLQDLHK
DAENRTAIKFNQLEERFQLFETDIVNIISNISYTAHHLRTLTSNLNEVRTTCTDTLTKHT
DDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVIMEEMKLVDSKHGQLIKNFT
ILQGPPGPRGPKGDRGSQGPPGPTGNKGQKGEKGEPGPPGPAGERGPVGPAGPPGERGGK
GSKGSQGPKGSRGSPGKPGPQGPSGDPGPPGPPGKEGLPGPQGPPGFQGLQGTVGEPGVP
GPRGLPGLPGVPGMPGPKGPPGPPGPSGAVVPLALQNEPTPAPEDNGCPPHWKNFTDKCY
YFSIEKEIFEEAKLFCEDKSSHLVFINTREEQQWIKKQMVGRESHWIGLTDSEHENEWKW
LDGTSPDYKNWKAGQPDNWGHGHGPGEDCAGLIFAGQWNDFQCEDVNNFICEKDRETVLS
SAL
Download sequence
Identical sequences ENSMMUP00000006201 9544.ENSMMUP00000006201 ENSMMUP00000006201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]