SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006205 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006205
Domain Number 1 Region: 467-756
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.8e-76
Family Protein kinases, catalytic subunit 0.000000285
Further Details:      
 
Domain Number 2 Region: 311-394
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-34
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 62-154
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-21
Family I set domains 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006205
Domain Number - Region: 170-257
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00275
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006205   Gene: ENSMMUG00000004668   Transcript: ENSMMUT00000006596
Sequence length 937
Comment pep:known_by_projection chromosome:MMUL_1:1:66552597:66961857:1 gene:ENSMMUG00000004668 transcript:ENSMMUT00000006596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTL
DEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRN
LDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACAR
FIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSS
VPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIG
IPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHS
YCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIAL
LFFFICVCRNNQKSSSPPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELG
ECAFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLG
AVTQEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIA
AGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMP
PEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPR
MYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSN
LSNPRYPNYIFPSQGITPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPTG
PPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGMGIT
VFGNKSQKPYKIDAKQASLLGDANIHGHTESMISAEL
Download sequence
Identical sequences A0A2K6ASI9 F6RUP2
ENSMMUP00000006205 9544.ENSMMUP00000006205 XP_007976650.1.81039 XP_011762784.1.29376 XP_014996735.1.72884 XP_015290264.1.63531 ENSMMUP00000006205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]