SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006285 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006285
Domain Number 1 Region: 31-143
Classification Level Classification E-value
Superfamily Immunoglobulin 2.99e-20
Family V set domains (antibody variable domain-like) 0.00021
Further Details:      
 
Domain Number 2 Region: 118-235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000137
Family C1 set domains (antibody constant domain-like) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006285   Gene: ENSMMUG00000021971   Transcript: ENSMMUT00000006680
Sequence length 334
Comment pep:novel chromosome:MMUL_1:4:26357387:26363289:1 gene:ENSMMUG00000021971 transcript:ENSMMUT00000006680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMASSLAFLLLSFHVSFFLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSA
ETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDDIAAGKAALRIHNVTASD
SGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPKIQWS
NAKGQNIPAVEAPVVADGVGLYAVAASVIMRGGSGESVSCIIRNSVLGLEKTASISIADP
FFRSAQPWIAALAGTLPILLLLLGGASYFLWRQHKEITALSSEIESEQEMKERGYAATKQ
EISLRESLQEELKRRKIQYLTRGKESSSETDKSA
Download sequence
Identical sequences XP_014991234.1.72884 XP_014991235.1.72884 ENSMMUP00000006285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]