SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006290 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006290
Domain Number 1 Region: 89-147,216-364
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-42
Family Sulfatase-modifying factor-like 0.0000000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006290   Gene: ENSMMUG00000004734   Transcript: ENSMMUT00000006685
Sequence length 369
Comment pep:known_by_projection chromosome:MMUL_1:2:56556022:56667343:1 gene:ENSMMUG00000004734 transcript:ENSMMUT00000006685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPALGLVCGRYPESGRVLLLLLLSLLCGAAGSEEAGTSAVAGSLAGSCGCGTPQRPGV
HGSSGAAHRYSREANAPGSVPGERPLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVT
IDAFYMDAYEVSNAEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWW
LPVKGANWRHPEGPDSTIRHRMTNCSLRTSEQCSLFHCIPSLDFNPKPADAYVSSDRLFP
WGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDW
WTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRC
AADRLPTMD
Download sequence
Identical sequences ENSMMUP00000006290 9544.ENSMMUP00000006290 ENSMMUP00000006290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]