SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006318 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006318
Domain Number 1 Region: 6-414
Classification Level Classification E-value
Superfamily ALDH-like 4.71e-106
Family ALDH-like 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006318   Gene: ENSMMUG00000004751   Transcript: ENSMMUT00000006715
Sequence length 430
Comment pep:known_by_projection chromosome:MMUL_1:1:21516710:21535097:-1 gene:ENSMMUG00000004751 transcript:ENSMMUT00000006715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGPHRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTN
STVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRVLREAG
LPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFRTFPRLAG
ECGGKNFHFVHCSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHG
RIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCI
VESKDPQEPIMKEEIFGPILTVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEA
TKVLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKP
LGDWSYAYMQ
Download sequence
Identical sequences 9544.ENSMMUP00000006318 ENSMMUP00000006318 ENSMMUP00000006318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]