SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006431 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006431
Domain Number 1 Region: 572-644
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-20
Family SH3-domain 0.00079
Further Details:      
 
Domain Number 2 Region: 735-814
Classification Level Classification E-value
Superfamily SH3-domain 7.74e-20
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 645-736
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-18
Family SH3-domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006431
Domain Number - Region: 143-176
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 0.0628
Family Iron-containing alcohol dehydrogenase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006431   Gene: ENSMMUG00000004818   Transcript: ENSMMUT00000006838
Sequence length 816
Comment pep:known_by_projection chromosome:MMUL_1:9:94848993:94973581:-1 gene:ENSMMUG00000004818 transcript:ENSMMUT00000006838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLAECDGSSKAVVNGLAPGSNGQDKDMDPTKICTGKGAVTLRASSSYRETPSSSPVSPQE
TPQHESKPGLEPEPSSADEWRLSSSADANGNAQPSSLAAKGYRSVHPNLPSDKSQGATSS
SAAQPEVIVVPLYLVNTDRGQEGTARPPAPLGPLGCVPTIPATASAASPLTFPTLDDFIP
PHLQRWSHHSQPARASGSFAPISQTPPSFSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDS
SPLLNEFSGTILAHCNLCLPGSVMPGLLGLTMCCINLTYTVCSFITEQQKRLSSLSDPVS
ERRVGEQDSAPTQEKPTSPGRAAEKRAKDDSRRVVKSAQDLSDVSMDEVGIPLRNTERSK
DWYKTMFKQIHKLNRDDDSDLYSPRYSFSEDTKSPLSVPRSKSEMSYIDGEKVVKRSATL
PLPARSSSLKSSPERNDWEPPDKKVDTRKYRAEPKSIYEYQPGKSSVLTNEKMSSAISPT
PEISSETPGYIYSSNFHAVKRESDGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRP
SSSASTKDSESPRHFIPADYLESTEEFIRRRHDDKEMRPARAKFDFKAQTLKELPLQKGD
IVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNF
NGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYM
DLPFSASPSRSATASPQQPQAQQRRVTPDRSQTSQDLFSYQALYSYIPQNDDELELRDGD
IVDVMEKCDDGWFVGTSRRTRQFGTFPGNYVKPLYL
Download sequence
Identical sequences ENSMMUP00000006431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]