SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006437 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006437
Domain Number 1 Region: 27-124
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000116
Family V set domains (antibody variable domain-like) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006437   Gene: ENSMMUG00000004843   Transcript: ENSMMUT00000006844
Sequence length 218
Comment pep:known chromosome:MMUL_1:19:41521170:41531218:1 gene:ENSMMUG00000004843 transcript:ENSMMUT00000006844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLLALVVGAALVSSAWGGCVEVDSETEAVYGMTFKILCISCKRRSETTAETFTEWTFR
QKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYE
CHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIWLVAEMVY
CYKKIAAATETAAQENASEYLAITSESKENCTGVQVAE
Download sequence
Identical sequences A0A0A0MX70 A0A0D9QX16 A0A2K5NWE1 A0A2K5V251 A0A2K6DUH9 A0A2K6LGZ8 F6QID2
ENSMMUP00000006437 NP_001245096.1.72884 XP_005588869.1.63531 XP_007994487.1.81039 XP_011763554.1.29376 XP_011898907.1.92194 XP_017703382.1.44346 9544.ENSMMUP00000006437 ENSMMUP00000006437 ENSPANP00000011771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]