SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006441 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006441
Domain Number 1 Region: 163-405
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-86
Family Eukaryotic proteases 0.00000000344
Further Details:      
 
Domain Number 2 Region: 51-157
Classification Level Classification E-value
Superfamily SRCR-like 5.49e-16
Family Hepsin, N-terminal domain 0.00000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006441   Gene: ENSMMUG00000004844   Transcript: ENSMMUT00000006848
Sequence length 417
Comment pep:known chromosome:MMUL_1:19:41532514:41558256:1 gene:ENSMMUG00000004844 transcript:ENSMMUT00000006848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKEGGRTVPCCSGPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSAD
ARLMVFDKTEGTWRLLCSSRSNTRVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCV
DEGRLPHTQRLLEVISVCDCPRGRFLATVCQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYH
GGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Download sequence
Identical sequences A0A2K5MA32 A0A2K5YAE7 A0A2K6CZR4 F6QHU6 G7PX79
ENSMMUP00000006441 9544.ENSMMUP00000006441 XP_005588873.1.63531 XP_011763552.1.29376 XP_011837676.1.47321 XP_011837677.1.47321 XP_011898911.1.92194 XP_011898915.1.92194 XP_011898916.1.92194 XP_014979033.1.72884 ENSMMUP00000006441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]