SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006485 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006485
Domain Number 1 Region: 1170-1332,1360-1439
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.33e-40
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 637-864
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.83e-39
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 112-233,335-402
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-30
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 1506-1728
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.61e-28
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006485   Gene: ENSMMUG00000004878   Transcript: ENSMMUT00000006893
Sequence length 2075
Comment pep:known chromosome:MMUL_1:10:83498223:83614235:1 gene:ENSMMUG00000004878 transcript:ENSMMUT00000006893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESASPPSSAAAPAAEPGVTTEQPGPQSPPSSPPGLEEPLDGADPHVPHPDLAPVAFFC
LRQTTSPRNWCIKMVCNPYPPQPWLIGALQGLKDLGPVQPYRDPSVLLRRLRVQQVFDDF
IFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVR
VLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFL
EENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVY
DFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWVE
IMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLS
SSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQSRRQALGPEAPAPAKPGPHA
KEPRHYNGKTKGQGDEGHLRSRHCQALQGPASPGNDHSGRGKPGPQSPLDATPHTLVQPI
PATLASDPASCPCCQHEAGRRPSGLGSTDSGQEGSGSGSSAGGEDEADGDGTRSSEDRAS
SELGKEEEEEQQADGAVWLCGDVWRETRAKLRGIVDSKYFNRGIMMAILVNTVSMGIEHH
EQAKELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIVGQ
ADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMH
IFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASLYF
VALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDDDQSSSNMEEFDKLQEGLDSSGDPK
LFPIPMTPNGHLDPSLPLGGHLGPAGAAGPAPRLSLQPDPMLVALGSRKSSVMSLGRMSY
DQRSLSSSRSSYYGPWGRSGAWASRRSSWNSLKHKPPSAEHESLLSAERGGGARVCEVAG
DEGLPRPAPLHAPHAPHAHHAHHGPHLAHRHRHHRRTLSLDTRDSVDLAELVPTVGAHPR
AAWRAAGPAPGHEDCNGRMPSIAKDVFTKMGDRRDRGEDEEEIDYTLCFRVRKMIDVYKP
DWCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEAGST
ERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSL
ASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFII
FGILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYRWVHHKYNFDNLGQALMSLFVLASK
DGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQ
HQEAEEARRREEKRLRRLEKKRRSEWVPVEDFGAGRKQMIQPLCPGLSHFSQHLSRMNVL
PSLSPFPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMG
ITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLL
FMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMK
DTLRDCTHDKRTCLNTLQFVSPLYFVSFVLTAQFVLINVVVAVLMNHLDDSNKEAQEDAE
MDAELELEMAHGLGPGPRLPAGSPGAPGRGPGGAGGGGDAEGGLCRRCYSPAQENLWLDS
VSLIIKDSLEGELTIIDNLSGSIFHHYSSPAGCKKCHHDKQEVQLAETEAFSLNSDRSSS
ILLGDDLSLEDPTACPPGPKDSKGELDPPEPMCVRDLDECFFPLSSTAVSPGPENFLCEM
EEIPFNPVQSWLKHDSSQAPPSPFSPDASSPLLPMPAEFFHPAVSASQKGPEKGTGTGTL
PKIALQGSWASLRSPRVNCTLLRQATGSDTSLDASPSSSAGSLQTTLEDSLTLSDSPRRA
LGPPAPAPGPRAGLSPAAHRRLSLRGRGLFSLRGL
Download sequence
Identical sequences ENSMMUP00000006485 9544.ENSMMUP00000006485 ENSMMUP00000006485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]