SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006497 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006497
Domain Number 1 Region: 22-403
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.05e-63
Family L-arabinose binding protein-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006497   Gene: ENSMMUG00000010987   Transcript: ENSMMUT00000006906
Sequence length 433
Comment pep:known chromosome:MMUL_1:14:104215268:104517284:1 gene:ENSMMUG00000010987 transcript:ENSMMUT00000006906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMPLMKNPILRN
Download sequence
Identical sequences A0A2I3GM71 A0A2I3LGC6 A0A2I3T7L8 A0A2J8XXD6 A0A2K5JWQ0 A0A2K5N3Z6 A0A2K5PSN5 A0A2K5TWX3 A0A2K5YF79 A0A2K6DC99 A0A2K6JQF9 A0A2K6TCP9 H9ENK7
ENSMMUP00000006497 XP_003253124.1.23891 XP_005579563.1.63531 XP_008018902.1.81039 XP_008952007.1.60992 XP_010332908.1.74449 XP_011759833.1.29376 XP_011782043.1.43180 XP_011857779.1.47321 XP_011921935.1.92194 XP_014971074.1.72884 XP_016777398.1.37143 XP_017400296.1.71028 XP_017704357.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]