SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006519 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006519
Domain Number 1 Region: 20-121
Classification Level Classification E-value
Superfamily Immunoglobulin 6.47e-45
Family V set domains (antibody variable domain-like) 0.0000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006519   Gene: ENSMMUG00000004909   Transcript: ENSMMUT00000006931
Sequence length 125
Comment pep:known_by_projection chromosome:MMUL_1:7:169767338:169768542:-1 gene:ENSMMUG00000004909 transcript:ENSMMUT00000006931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLTWSILFLVAAATCAHSQVQLVQSGPEVKQPGASVKVSCKASGYSFTTYGMNWVRQAP
GQGLEWMGWMNTYTGNPTYAQGFTERFVFSMDTSVSTVYLQISSLKGEDTAVYYCARYTV
WKPTS
Download sequence
Identical sequences ENSMMUP00000006519 ENSMMUP00000006519 9544.ENSMMUP00000006519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]