SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006529 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006529
Domain Number 1 Region: 418-703
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-81
Family Protein kinases, catalytic subunit 0.000000000916
Further Details:      
 
Domain Number 2 Region: 141-243
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-20
Family I set domains 0.0000797
Further Details:      
 
Domain Number 3 Region: 249-350
Classification Level Classification E-value
Superfamily Immunoglobulin 1.84e-19
Family I set domains 0.0000399
Further Details:      
 
Domain Number 4 Region: 29-105
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000133
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006529   Gene: ENSMMUG00000004919   Transcript: ENSMMUT00000006943
Sequence length 762
Comment pep:known_by_projection chromosome:MMUL_1:6:173597294:173605365:1 gene:ENSMMUG00000004919 transcript:ENSMMUT00000006943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLSALLGVLLSVPGPPVLSLEASEEVELEPCLAPSMEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARASMIVLQNLTLTIDDS
LTSSNDDEDPQSHRDSSNGHIYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGIIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPGTGRIPHL
ACGSLTPAGRTKSPTLQFSLESGSSSKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLW
EFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSE
MEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPQSS
EGPLAFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGIHHI
DYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFS
LLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLT
FGPYSPAGGDTSSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT
Download sequence
Identical sequences F7CEB0
ENSMMUP00000006529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]