SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006530 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006530
Domain Number 1 Region: 41-176
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.19e-20
Family Canonical RBD 0.004
Further Details:      
 
Domain Number 2 Region: 223-318
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000833
Family Canonical RBD 0.005
Further Details:      
 
Domain Number 3 Region: 176-211
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000628
Family Ran binding protein zinc finger-like 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006530
Domain Number - Region: 639-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00595
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006530   Gene: ENSMMUG00000004921   Transcript: ENSMMUT00000006944
Sequence length 815
Comment pep:known chromosome:MMUL_1:2:86300607:86333557:-1 gene:ENSMMUG00000004921 transcript:ENSMMUT00000006944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDKRVSRTERSGRYGSIIDRDDRDERESRSRRRDSDYKRSSDDRRGDRYDDYRDYDSP
ERERERRNSDRSEDGYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMES
FEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRP
KFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESVQSVDYYCDTIILRNIAP
HTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPP
LKIDGKTIGVDFAKSARKDLVLSDGNRVSAFSVASTAIAAAQWSSTQSQSGEGGSVDYSY
LQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTS
NPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYYDPTTGLYY
DPNSQYYYNSLTQQYLYWDGEKETYVPAAESSSHQQTGLPPAKEGKEKKEKPKSKTAQQI
AKDMERWAKSLNKQKENFKNSFQPVNSLREEERRESAAADAGFALFEKKGALAERQQLIP
ELVRNGDEENPLKRGLVAAYSGDSDNEEELVERLESEEEKLADWKKMACLLCRRQFPNKD
ALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEP
KRKKQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLK
GAGLGAKGSAYGLSGADSYKDAVRKAMFARFTEME
Download sequence
Identical sequences A0A096MUY4 A0A0D9RPI8 A0A2K5NGN8 A0A2K5UWT9 H2QMN1 I0FNA7
ENSPTRP00000025795 ENSMMUP00000006530 ENSMMUP00000006530 ENSPANP00000003653 NP_001248103.1.72884 XP_001167585.1.37143 XP_003818887.1.60992 XP_005547231.1.63531 XP_005547232.1.63531 XP_007982477.1.81039 XP_008970483.1.60992 XP_011889163.1.92194 XP_014986274.1.72884 ENSPTRP00000025795 9544.ENSMMUP00000006530 9598.ENSPTRP00000025795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]