SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006635 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000006635
Domain Number - Region: 196-228
Classification Level Classification E-value
Superfamily Kringle-like 0.0593
Family Kringle modules 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006635   Gene: ENSMMUG00000005009   Transcript: ENSMMUT00000007062
Sequence length 384
Comment pep:known chromosome:MMUL_1:12:28542968:28599438:-1 gene:ENSMMUG00000005009 transcript:ENSMMUT00000007062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQAGFPLGILLLFWVSYVTDFSLILLIKGGALSGTDTYQSLVNKTFGFPGYILLSVLQF
LYPFIVDPENVFIGRHFIIGLSTVTFTLPLSLYRNIAKLGKVSLISTGLTTLILGIVMAR
AISLGPHIPKTEDAWVFAKPNAIQAVGVMSFAFICHHNSFLVYSSLEEPTVAKWSRLIHM
SIVISVFICIFFATCGYLTFTGFTQGDLFENYCRNDDLVTFGRFCYGVTVILTYPMECFV
TREVIANVFFGGNLSSVFHIVVTVMVITVATLVSLLIDCLGIVLELNGVLCATPLIFIIP
SACYLKLSEEPRTHSDKIMSYVMLPIGAAVMVFGFVMAITNPQDCTHGQEMFYCFPDNFS
LTNTSESHIQQTTQLSILNISIFQ
Download sequence
Identical sequences A0A2K5NDT2 A0A2K5W918 A0A2K6BRI2 F7AM69
ENSMMUP00000006635 ENSMMUP00000006635 9544.ENSMMUP00000006635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]