SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006763 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006763
Domain Number 1 Region: 617-1132
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.61e-121
Family alpha-mannosidase, C-terminal domain 0.0000123
Further Details:      
 
Domain Number 2 Region: 123-442
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.42e-100
Family alpha-mannosidase 0.0000000186
Further Details:      
 
Domain Number 3 Region: 497-611
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 9.48e-29
Family alpha-mannosidase, domain 2 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006763   Gene: ENSMMUG00000005103   Transcript: ENSMMUT00000007197
Sequence length 1133
Comment pep:known_by_projection scaffold:MMUL_1:1099214740815:48250:63637:-1 gene:ENSMMUG00000005103 transcript:ENSMMUT00000007197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPTRHQNGGNFPRSQISVLQNRIEQLEQL
LEENHEIISHIKDSVLELTANAEGPPAMLPYYTVNGSWVVPPEPRPSFFSIPQDCQFALG
GRGQKPELQMLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGWI
KTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINAQKRAAEGKLVGNG
QLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGATPRSGWAVDPFGHSSTMPYLL
RRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDIPHTCG
PDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERYLLPALSLHRGIRRPGSVWAMP
HGGSLLSLLKNEWATTFHRILLFSHVSTFWCSNKLPGQGDSLEVNDSLVRHCSLQTSDSW
FPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHSRHSGLA
GRYPLSDFTLLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHY
LVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSSPRFVVLFNPLEQERFSMVS
LLVNSPRVRVLSEEGQPLAVQISAHWSSATEVVPDVYQVSVPVRLPALGLGVLQLQLGLD
GHRTLPSSVRVYLHGRQLSVSRHEAFPLRVIDSGSSDFALSNRYMQVWFSGLTGLLKSIR
RVDEEQEQQVDMEFLVYGTRTSKDKSGAYLFLPDGEAKPSPRSPLCCMSLKALSSQRWLH
TTSMFTRWSGFTICQGWRGCLWTYHPWWTSGTTSTRSWPCASIQTSTARVQPRRYLKKLP
LQANFYPMPVMAYIQDAHKRLTLHTAQALGVSSLKDGQLEVILDRRLMQDDNRGLGQGLK
DNKRTCNRFRLLLERRTVGSEVQDSHSTSYPSLLSHLTSMYLNTPALALPVARTQLPGPG
LRSFHPLASSLPCDFHLLNLRTLQAEEDTLPSVEMALILHRKGFDCGLEAKNLGFNCTTS
QGKVALGSLFHGLDVVFLQPTSLTLLYPLASPSNSTDVYLEPMEIATFRLRLG
Download sequence
Identical sequences ENSMMUP00000006763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]