SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006821 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006821
Domain Number 1 Region: 713-824
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000496
Further Details:      
 
Domain Number 2 Region: 157-262
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 928-1032
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000899
Further Details:      
 
Domain Number 4 Region: 264-368
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00023
Further Details:      
 
Domain Number 5 Region: 49-154
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 6 Region: 476-580
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00055
Further Details:      
 
Domain Number 7 Region: 580-687
Classification Level Classification E-value
Superfamily SRCR-like 5.36e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00085
Further Details:      
 
Domain Number 8 Region: 371-475
Classification Level Classification E-value
Superfamily SRCR-like 1.11e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 
Domain Number 9 Region: 820-927
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006821   Gene: ENSMMUG00000005150   Transcript: ENSMMUT00000007258
Sequence length 1155
Comment pep:known chromosome:MMUL_1:11:7769222:7803814:-1 gene:ENSMMUG00000005150 transcript:ENSMMUT00000007258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLRMVLLEDSGSADVRRHFVNLSPFTIAVVLLLSACFVTSSLGGTTKELRLVDGENKC
SGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKATGWANSSAGSGRIWMDHVSC
RGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSDLEMRLTNGGNKCSGRIEIKFQGQW
GTVCDDNFNIDHASVVCKQLECGSAVSFSGSANFGEGSGPIWFDDLICSGNESALWNCKH
QGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSHDA
AVACKQLGCPTAITAIGRVNASEGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNED
AGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRGWGLKEADVVCRQLGCGSAL
KTSYQVYSKIQATNTWLFLSSCNGNETSLWDCKNWQWGGLTCDHYEEAKITCSAHREPRL
VGGDIPCSGRVEVKHGDTWGSVCDSDFSLEAASVLCRELQCGTVVSILGGAHFGEGNGQI
WAEEFQCEGHESHLSLCPVAPRPEGTCSHSRDVGVVCSRYTEIRLVNGKTPCEGRVELKT
LDAWGSLCNSHWDIEDAHVLCQQLKCGVALSTPGGAHFGKGNGQVWRHMFHCTGTEQHMG
DCPVTALGASLCPSGQVASVICSGNQSQTLSSCNSSSLGPTRPTIPEESAVACIESGQLR
LVNGGGRCAGRVEIYHEGSWGTICDDSWDLSDAHVVCRQLGCGEAINATGSAHFGEGTGP
IWLDEMKCNGKESRIWQCHSHGWGQQNCRHKEDAGVICSEFMSLRLTSEASREACAGRLE
VFYNGAWGSVGRSSMSETTVGVVCRQLGCADKGKINPASLDKAMSIPMWVDNVQCPKGPD
TLWQCPSSPWEKRLARPSEETWITCDNKIRLQEGPTSCSGRVEIWHGGSWGTVCDDSWDL
NDAQVVCQQLGCGPALKAFKEAEFGQGTGPIWLNEVKCKGNESSLWDCPARRWGHNECGH
KEDAAVNCTDISAHKTPQKAPTGHTSRQSSLIAVGILGVVLLAIFVALFLTQKRRQRQQL
TVSSRGENLVHQIQYREMNSCLNADDLDLMNSSENSNESADFNAAELISVSKFLPISGME
KEAILRHTEKENGNL
Download sequence
Identical sequences A0A2K6BTA1 G7N5V9
ENSMMUP00000006821 ENSMMUP00000006821 XP_005570074.1.63531 XP_011744008.1.29376 XP_015006461.1.72884 9544.ENSMMUP00000006821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]