SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006838 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006838
Domain Number 1 Region: 2-429
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.47e-63
Family L-arabinose binding protein-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006838   Gene: ENSMMUG00000005169   Transcript: ENSMMUT00000007279
Sequence length 737
Comment pep:novel chromosome:MMUL_1:14:15374924:15393259:1 gene:ENSMMUG00000005169 transcript:ENSMMUT00000007279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFAVAEAEGNQAFLPNITVGLQIYDSCISGIQALGSPLALLSNQLPSATNYACGSQQHIL
GVVGGMTFLDSEPLAELLSVYRVPQISHGSQHPQFSNCFQFPSFLRTVPSSTHQPWVLAK
LLSYFNRTWVGLVSSDNSNFEWLEQQLQKQIGDEGGCVAFSEINSVDDSINSAANIITQT
PAAMVIIYDCYRFHFRLLVGALQGNNVTGRTWIFSTSFAFNPSMLGPKAHELLNGSLSLT
IHLGIIPIFRDFLLALCPGNSLMRKLWEELQGCRGSGFGTSIQSAREGAWHRTGLENMTT
AHLSAFKLPDLTAIYQAHLAAKALWVAHPNLMSCCPREGPFLGGTYANAWEARPSHERVN
HQVRKLVNFATKAQEEVFFTKDGEVLTTFDVKNIYVLPDLSGRTAIVGHFDFRAPSGKDI
LFDDSAIVWAEGLLKEILMMSCFPTTLKIPKSLFLPITVSLTLCTVPDLWNTFLIIVACQ
KCSDNQWPNVQKRKCIPKTLDFLFYHEPLDTALAVCTALLFLLALAILANNCQLSYLLLS
SLALSFLCPFKFIGHPDPITCAVHQAAFGVTFTVCMSTVLAKTIVVVAAFHATQPDTQLR
STILTACSLTQAALCALWVTRWPPQPGPTVTVKCDKGSLELFYAMLGYLSLLDLVSLLVT
FPTCQLPDTFSEAKHITLSVVCSCVGVSLIPAHMHAHSKDTTAVEVFFILASGGGLMSSL
FLPKCYIILLHPEKNTK
Download sequence
Identical sequences ENSMMUP00000006838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]