SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006857 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006857
Domain Number 1 Region: 468-652
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.15e-44
Family cAMP-binding domain 0.00033
Further Details:      
 
Domain Number 2 Region: 251-464
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-33
Family Voltage-gated potassium channels 0.0023
Further Details:      
 
Domain Number 3 Region: 38-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.36e-19
Family Flavin-binding PAS domain 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006857   Gene: ENSMMUG00000005183   Transcript: ENSMMUT00000007298
Sequence length 905
Comment pep:known_by_projection chromosome:MMUL_1:16:59042942:59066800:1 gene:ENSMMUG00000005183 transcript:ENSMMUT00000007298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKRSSRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKYRTISQ
IPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESRRGACGYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACICS
LTSVGFGNVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVK
EFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCP
AFSGASKGCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGK
NDIFGEPVSLHARPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFADSFWSKLEVTFN
LRDAAGGLHSSPRQAPGSQDHQGFFLNDNQSDAAPPLSISDASGLWPELLQKMPPRHSPP
TPQGDPDCWPLKLGSRLEQLQAQMNRLESRVSSDLSRILQLLQQPMPQGQATYILEAPAS
NDLALFPIASEMTSPGPRLPQGFLPPAQTPSYGDLDDCSAKHRSSSPRMPHLAVATDKTL
APSSEEEQPEGLWAPLASPLYPLKVQGLICGPCFSSLPEHLGSVPKQLDFQRHGSDPGFA
GSWGH
Download sequence
Identical sequences F7CYQ6
ENSMMUP00000006857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]