SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006942 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006942
Domain Number 1 Region: 195-316
Classification Level Classification E-value
Superfamily vWA-like 5.11e-35
Family Integrin A (or I) domain 0.0000331
Further Details:      
 
Domain Number 2 Region: 304-406
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-25
Family Integrin domains 0.0032
Further Details:      
 
Domain Number 3 Region: 43-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000146
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 4 Region: 422-493
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.000000000562
Family Integrin beta tail domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006942   Gene: ENSMMUG00000005245   Transcript: ENSMMUT00000007385
Sequence length 575
Comment pep:known_by_projection chromosome:MMUL_1:11:50250846:50260063:-1 gene:ENSMMUG00000005245 transcript:ENSMMUT00000007385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALPVVLVLLLVLSRGESELDAKTPSTGEATEWGNPHLSLLGSCQPAPSCQKCIVSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRITLRPGDKLPLAAAFFGTGESRRKQGTGDKGMDKLTQSEACHILGSQSWLG
WLKGHAQVHSLTPTVPQEQIGWRNVSRLLVFTSDDTFHTAGDGKLGGIFMPSDGHCHLDS
NGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELSKLIPKSAVGELSEDS
SNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKTEGKAEDRGQCNHVQINQ
TVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSDTQAQAPHCSDGQGHL
QCGVCRDCAECGAFGTGLLATNCSTACAHTNVTLVLAPILDDGWCKERTLDNHLFFFLVE
DDARGRVVLRVRPQEKGADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEK
EQQQLNWKQDSNPLYKSAITTTINPRFQEADSPIL
Download sequence
Identical sequences ENSMMUP00000006942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]