SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006970 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006970
Domain Number 1 Region: 285-650
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.3e-65
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 
Domain Number 2 Region: 29-235,282-349
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.35e-27
Family Quinoprotein alcohol dehydrogenase-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006970   Gene: ENSMMUG00000005271   Transcript: ENSMMUT00000007416
Sequence length 918
Comment pep:known chromosome:MMUL_1:3:2583820:2606854:-1 gene:ENSMMUG00000005271 transcript:ENSMMUT00000007416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFFFQFSNLLGTVYRRGNLNFTCDGNSVISPVGNRVTVFDLKNNKSDTLPLAARYNVKCV
GLSPDGRLAIIVDEGGDALLVSLVCRSVLHHFHFKGSVHSVSFSPNGRKFVVTKGNIAQM
YHAPGKKREFNAFVLDKTYFGPYDETTCIDWTDDSRCFVVGSKDMSTWVFGAERWDNLIY
YALGGHKDAIVACFFESNSLDLYSLSQDGVLCMWQCDTPPEGLRLKPPAGWKADLLQREE
EEEEEEDQEGDRETTIRGKATPAEEEKTGKVKYSRLAKYFFNKEGDFNNLTAAAFHKKSH
LLVTGFASGIFHLHELPEFNLIHSLSISDQSIASVAINSSGDWIAFGCSGLGQLLVWEWQ
SESYVLKQQGHFNSMVTLAYSPDGQYIVTGGDDGKVKVWNTLSGFCFVTFTEHSSGVTGV
TFTATGYVVVTSSMDGTVRAFDLHRYRNFRTFTSPRPTQFSCVAVDASGEIVSAGAQDSF
EIFVWSMQTGRLLDVLSGHEGPISGLCFNPMKSILASASWDKTVRLWDMFDSWRTKETLA
LTSDALAVTFRPDGAELAVATLNSQITFWDPENAVQTGSIEGRHDLKTGRKELDKITAKH
AAKGKAFTTLCYSADGQSILAGGMSKFVCIYHVREQILMKRFEISCNLSLDAMEEFLNRR
KMTEFGNLALIDQDAGQEDGVAIPLPGVRKGDMSSRHFKPEIRVTSLRFSPTGRCWAATT
TEGLLIYSLDTRVLFDPFELDTSVTPGRVREALRQEDFTRAILMALRLNESKLVQEALEA
VPRGEIEVVTSSLPELYVEKVLEFLASSFEVSRHLEFYLVWTHKLLMLHGQKLKSRAGTL
LPVIQFLQKSIQRHLDDLSKLCSWNRYNMQYALAVSKQRGTKRSLEPLGSEEEEEASEDD
SLHLLGGGGRDSEEGMLA
Download sequence
Identical sequences G7MMH8
ENSMMUP00000006970 9544.ENSMMUP00000006970 ENSMMUP00000006970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]