SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007214 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007214
Domain Number 1 Region: 238-436
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.36e-48
Family Reprolysin-like 0.0002
Further Details:      
 
Domain Number 2 Region: 453-529
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 9.72e-16
Family Blood coagulation inhibitor (disintegrin) 0.00075
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007214
Domain Number - Region: 684-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007214   Gene: ENSMMUG00000029927   Transcript: ENSMMUT00000007682
Sequence length 759
Comment pep:known_by_projection chromosome:MMUL_1:16:54851455:54870944:1 gene:ENSMMUG00000029927 transcript:ENSMMUT00000007682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLRRWAFAALLLPLLPPPGLGTQGSAGALRWGRLPQLGGPGAPEVTEPSRLVRESSGG
EVRKQQLDTRVRQEPPGGPPVHLAQVSFVIPAFNSNFTLDLELNHHLLSSKYVERHFSRE
GTTQHSTGAGDHCYYQGKLRGNLHSFAALSTCQGLHGVFSDGNLTYIVEPQDMAGPWGAP
QGPLPHLIYRTPLLPDPLGCRELGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKY
VELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQ
VQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSRGGGVNEY
GNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSID
EYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLT
HDAMCSDGLCCRRCKGRQRGRAWGREVGSCDIAETCTGDSSQCPPNLHKLDGYYCDHEQG
RCYGGRCKTRDRQCQALWGHAAADRFCYEKLNVEGTERGSCGRKGSGWVQCSKQDVLCGF
LLCVNVSGAPRLGDLVGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNML
CLDHRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPP
TGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFK
Download sequence
Identical sequences ENSMMUP00000007214 ENSMMUP00000007214 9544.ENSMMUP00000007214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]