SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007320 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007320
Domain Number 1 Region: 40-121
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.34e-24
Family MHC antigen-recognition domain 0.0000111
Further Details:      
 
Domain Number 2 Region: 127-217
Classification Level Classification E-value
Superfamily Immunoglobulin 9.5e-17
Family C1 set domains (antibody constant domain-like) 0.00000766
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007320   Gene: ENSMMUG00000005534   Transcript: ENSMMUT00000007790
Sequence length 261
Comment pep:known chromosome:MMUL_1:4:32655511:32660224:-1 gene:ENSMMUG00000005534 transcript:ENSMMUT00000007790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPVWRDDLQNHTFLHTVYCQDGSPSMGLS
EAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKAFCEMMIQQIGPQLDGKI
PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGSGPTFVSAVD
GLSFQAFSYLNITPEPSDVFSCIVTHEIDRYTAIAYWVPQNALPSDLLENVLCGVAFGLG
VLGIIVGIVLIIYFRKPCSGD
Download sequence
Identical sequences A0A1D5QD08 A0A2K6C2L2
9544.ENSMMUP00000007320 ENSMMUP00000007320 NP_001180403.1.72884 XP_011727344.1.29376 ENSMMUP00000007320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]