SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007378 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007378
Domain Number 1 Region: 11-99
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 6.54e-31
Family Ribosomal L11/L12e N-terminal domain 0.0000106
Further Details:      
 
Domain Number 2 Region: 88-161
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.62e-18
Family Ribosomal protein L11, C-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007378   Gene: ENSMMUG00000016690   Transcript: ENSMMUT00000007851
Sequence length 178
Comment pep:novel chromosome:MMUL_1:3:15531113:15531649:1 gene:ENSMMUG00000016690 transcript:ENSMMUT00000007851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRIRVHPIPAASTMPPKFDPNKIKVLYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIA
KATGYGKGLRITMKLTIQNRQAQIEVVPSASALIIKALKKPPRDRKKQKNIKHSGNITFD
EIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
Download sequence
Identical sequences ENSMMUP00000007378 9544.ENSMMUP00000007378 ENSMMUP00000007378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]