SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007546 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007546
Domain Number 1 Region: 147-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000351
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 103-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000879
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 3 Region: 57-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000008
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007546
Domain Number - Region: 497-729
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00467
Family Rhodopsin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007546   Gene: ENSMMUG00000005722   Transcript: ENSMMUT00000008028
Sequence length 737
Comment pep:known chromosome:MMUL_1:19:14087638:14107606:1 gene:ENSMMUG00000005722 transcript:ENSMMUT00000008028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFCVWLTLLGAETQDSRDCARWCPENSSCVNATACRCNPGFSSSSEIFTSPTEICDDINE
CVPPSKVSCGKSSDCRNTEGSYDCVCNPGYELVSGAKTFKNESENTCQDVDECQQNPRLC
KSYGTCVNTLGSFTCQCLPGFKFKPEDPKLCTDVDECSSGLHQCDNSTVCFNIVGSYTCR
CRPGWEPKHGIPNNQKDTVCKEMNFPTWTLPPGVHSQTLSQFFNKVQDLDRDFKTSSANV
TIQNLIKLVDELMEAPGDIEALAPSVRHLIATQLLSNLEDILRILAKTLPEGPFTYLSPS
NTELTLMIQKQGDKNVTMGQSNARMKLNWAVAAGAKDPGPAVAGILSIQNMTTLLANASL
NLHSKKQAELEEIYESNIRGVRLRRLSAVNSVFLSHNNTKELNFPILFAFSHLESSGGKE
GRDPPAKDVMPGPRQELICAFWKSDSNRGGHWATEGCRVLGSKNGSTTCQCSHLSSFAIL
MAHYDLEDWKLSLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTI
FLAGIENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGLSTRWLC
LIGYGVPLLIVGVSAAVYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVIFVTTVW
KLTQKFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYVFTILNC
LQGAFLYLLHCLLNKKV
Download sequence
Identical sequences ENSMMUP00000007546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]