SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007647 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007647
Domain Number 1 Region: 434-927
Classification Level Classification E-value
Superfamily ALDH-like 3.01e-163
Family ALDH-like 0.000000000691
Further Details:      
 
Domain Number 2 Region: 23-223
Classification Level Classification E-value
Superfamily Formyltransferase 5.63e-50
Family Formyltransferase 0.0000000191
Further Details:      
 
Domain Number 3 Region: 227-327
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 6.44e-26
Family Post formyltransferase domain 0.0000139
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007647
Domain Number - Region: 345-433
Classification Level Classification E-value
Superfamily ACP-like 0.000208
Family Acyl-carrier protein (ACP) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007647   Gene: ENSMMUG00000005797   Transcript: ENSMMUT00000008131
Sequence length 928
Comment pep:known chromosome:MMUL_1:11:106145123:106206734:-1 gene:ENSMMUG00000005797 transcript:ENSMMUT00000008131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRWGSQALRRFSTGRVYFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKLPKWRVKGKTIKEVAEAYRSVGADLNVLPFCTQFIPMDIIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALMVRNLQFEDGKMIPASQYFSAGETSVVELTAEEVKVAETIKVIWAGILSNVP
IIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGED
QEAELVVDYVSKEVNEMMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLA
DVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGKPLNDSLPG
QRLSEHPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELEKAVRM
GMGAVFFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAH
LEKLLQYCETGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISK
FQNGDIDGVLQRANNTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGG
VKQSGFGKDLGEEALNEYLKTKTVTLEY
Download sequence
Identical sequences ENSMMUP00000038748 9544.ENSMMUP00000007647 ENSMMUP00000007647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]