SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007687 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007687
Domain Number 1 Region: 95-263
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-30
Family C-type lectin domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007687   Gene: ENSMMUG00000005832   Transcript: ENSMMUT00000008175
Sequence length 280
Comment pep:known chromosome:MMUL_1:11:10259008:10289175:-1 gene:ENSMMUG00000005832 transcript:ENSMMUT00000008175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPKYSSTRDMLDDDGDTTMSLHSQASATARRPEPRRTEHRAPSSTWRPVALTLLTLCLV
LLIGLAVLGLLFFQYYQLSNTGQGTISQMAERLGNTSRELQSLQVQNRKLSGSLQHVAEK
LCRELYNKTGVHRCSPCTDQWKWHGDKCYQFYKDGKSWEDCKYFCLSENCTMLKINKQED
LDFAIFQSHSPFFYSYWTGLLRPDSGKAWMWMDGTPFASELFEIIIDVTSPRSRDCVAIL
NGMIFSKDCQELKRCICERRAGMVKTESLHFPPETLGEGD
Download sequence
Identical sequences F7GR98
9544.ENSMMUP00000007687 ENSMMUP00000007687 ENSMMUP00000007687 NP_001253480.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]