SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007694 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000007694
Domain Number - Region: 187-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000143
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 237-282
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0275
Family RILP dimerisation region 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007694   Gene: ENSMMUG00000005839   Transcript: ENSMMUT00000008183
Sequence length 847
Comment pep:known_by_projection chromosome:MMUL_1:17:75994441:76056891:-1 gene:ENSMMUG00000005839 transcript:ENSMMUT00000008183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAEAADWLSSMPFQKHVYYPLTSGPEGPDVSVAAAAGAASMACAPPSAASGPQPFFQFK
PRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVLLKLI
RLAQFTIEYLLHSQEFLTSQLHTLEERLRLSHCEGEQSKKLLTKQVGEIKMLKEECKRRK
KMISTQQLMIEAKANYYQCHFCDKAFMNQAFLQSHIQRRHTEENSRFEYQKNAQIEKLRS
EIVVLKEELQLTRSELEAAHHASAVRFSKEYEMQKTKEEDFLKLFDRWKEEEKEKLVDEM
EKVKEMFMKEFKELTSKNSALEYQLSEIQKSNMQIKSNIGTLKDAHEFKEDRSPYPQDFH
NVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMIDDLNASNVFYKKRIEEL
GQRLQEQNELIITQRQQIKDFTCNPVNSISEPKVNAPALHTSETKSSLPMAQEQAFLSHI
LEPIEELSEEEKGRENEQKLNNNKMHLRKALKSNSSLTKGLRTMVEQNLMEKLETLGINA
DVHGISSDQLHRVLKSVESERHKQEREIPNFHQIREFLEHQVSCKIEEKALLSSDKYSVS
QMDTLSTGEVPKMIQLPPKNRQLIRQKAVSTDRTSVSKIKKNIMEDHFPRKSSTITTPPF
SSEEEQEDDDLIRAYASPGPLPVPPSQNKGSFGKNTVKSDADGTEGSEIEDTDDSPKPTG
ATIKTPTEKVEKMFSHRKNVNKPVGGTNVPEMFIKKEELQELKCADVEDEDWDISSLEEE
ISLGKKSGKEQKEPPPVKNEPHFAHVLNAWGAFNPKGPKGEGLQENESSTLKSSLVTVTD
WSDSSDV
Download sequence
Identical sequences ENSMMUP00000007694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]