SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007885 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007885
Domain Number 1 Region: 855-937
Classification Level Classification E-value
Superfamily DEATH domain 4.66e-22
Family DEATH domain, DD 0.00000813
Further Details:      
 
Domain Number 2 Region: 155-246
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000174
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 245-296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000353
Family TSP-1 type 1 repeat 0.00053
Further Details:      
 
Domain Number 4 Region: 298-353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 5 Region: 48-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000319
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007885   Gene: ENSMMUG00000005998   Transcript: ENSMMUT00000008392
Sequence length 945
Comment pep:known_by_projection chromosome:MMUL_1:9:65704052:65794026:-1 gene:ENSMMUG00000005998 transcript:ENSMMUT00000008392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTRSGARDALLLALLLCWDPRLSQAGTDSGSEALPDSFPSAPAEPLPYFLQEPQDAYIV
KNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEEL
FGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGV
PVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTAT
VIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPTPLNGGAFCEGQAFQKTACTTICP
VDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTL
SDPNSHLLEASGDAALYAGLVVAVFVVVAILMAVGVVVYRRNCRDFDTDITDSSAALTGG
FHPVNFKTARPNNPQLLHPSVPPDLTASAGIYRGPVYALQDSTDKIPMTNSPLLDPLPSL
KVKVYSSSTTGSGPGLADGADLLGVLPPGTYPSDFTRDTHLLHLRSASLGSQQLLGLPRD
PGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTV
LSPSVTCGPTGLLLCRPVILTVPHCAKVSVGDWIFQLKTQAHQGHWEEVVTLDEETLNTP
CYCQLEPRACHILLDQLGTYVFTGESYSRSAVKRLQLAVFAPALCTSLEYSLRVYCLEDT
PVALKEVLDLERTLGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKLLAKYQEIPFY
HIWSGSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLHTTLAETPAGSLDTLC
SAPGSAVTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKA
SPTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAVATDGDC
Download sequence
Identical sequences 9544.ENSMMUP00000007885 ENSMMUP00000007885 XP_015002918.1.72884 ENSMMUP00000007885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]