SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007905 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007905
Domain Number 1 Region: 21-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000115
Family V set domains (antibody variable domain-like) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007905   Gene: ENSMMUG00000006017   Transcript: ENSMMUT00000008415
Sequence length 220
Comment pep:known chromosome:MMUL_1:12:67574241:67603115:1 gene:ENSMMUG00000006017 transcript:ENSMMUT00000008415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLLLALNLLPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD
SAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP
PYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWALVVVGGVLACYSLLVTVAFCIFWMR
SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Download sequence
Identical sequences A0A2K6C7F5 Q0PDN3 Q0PDN4
NP_001036106.2.72884 NP_001274262.1.63531 XP_011716295.1.29376 ENSMMUP00000007905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]